>1aay_A mol:protein length:90  PROTEIN (ZIF268 ZINC FINGER PEPTIDE)
MERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTG
EKPFACDICGRKFARSDERKRHTKIHLRQKD