>1apj_A mol:protein length:74  FIBRILLIN
SAQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQI
CPYGSGIIVGPDDSA
>1apj_A mol:protein length:74  FIBRILLIN
SAQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQI
CPYGSGIIVGPDDSA