>1apm_I mol:protein length:20  PEPTIDE INHIBITOR PKI(5-24)
TTYADFIASGRTGRRNAIHD
>1apm_I mol:protein length:20  PEPTIDE INHIBITOR PKI(5-24)
TTYADFIASGRTGRRNAIHD
>1apm_E mol:protein length:350  cAMP-DEPENDENT PROTEIN KINASE
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVML
VKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYM
VMEYVAGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHK
WFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF