>1ayj_A mol:protein length:51  ANTIFUNGAL PROTEIN 1
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
>1ayj_A mol:protein length:51  ANTIFUNGAL PROTEIN 1
EKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC