>1b07_C mol:protein length:12  PROTEIN (SH3 PEPTOID INHIBITOR)
YEVPGPVPPRRR
>1b07_A mol:protein length:65  PROTEIN (PROTO-ONCOGENE CRK (CRK))
GSAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
HHHHHH
>1b07_C mol:protein length:12  PROTEIN (SH3 PEPTOID INHIBITOR)
YEVPGPVPPRRR