>1b07_A mol:protein length:65  PROTEIN (PROTO-ONCOGENE CRK (CRK))
GSAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
HHHHHH