>1b4g_A mol:protein length:30  POTASSIUM CHANNEL
MISSVCVSSYRGRKSGNKPPSKTCLKEEMA