>1b5u_A mol:protein length:130  PROTEIN (LYSOZYME)
KVFERCELARTLKRLGMDGYRGIALANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQI
NSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQN
RDVRQYVQGCGV