>1b9e_D mol:protein length:30  PROTEIN (INSULIN)
FVNQHLCGEHLVEALYLVCGERGFFYTPKT