>1bc8_C mol:protein length:93  PROTEIN (SAP-1 ETS DOMAIN)
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKL
SRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM