>1be3_E mol:protein length:196  CYTOCHROME BC1 COMPLEX
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFV
SSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLR
DPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAP
LNLEVPSYEFTSDDMVIVG
>1be3_F mol:protein length:110  CYTOCHROME BC1 COMPLEX
AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRV
FRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK
>1be3_H mol:protein length:78  CYTOCHROME BC1 COMPLEX
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELL
DFLHARDHCVAHKLFNSLK
>1be3_D mol:protein length:241  CYTOCHROME BC1 COMPLEX
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTED
EAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVR
ARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPA
TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLA
YRPPK
>1be3_J mol:protein length:62  CYTOCHROME BC1 COMPLEX
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY
ENK
>1be3_C mol:protein length:379  CYTOCHROME BC1 COMPLEX
MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDT
TTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVI
LLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTR
FFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLI
LALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALA
FSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLA
SVLYFLLILVLMPTAGTIENKLLKW
>1be3_B mol:protein length:439  CYTOCHROME BC1 COMPLEX
SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYEN
SNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDI
LMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLY
CPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAK
AKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSL
YQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSN
PDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINA
AKKFVSGRKSMAASGNLGHTPFIDEL
>1be3_K mol:protein length:56  CYTOCHROME BC1 COMPLEX
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPYINGKFKKDD
>1be3_G mol:protein length:81  CYTOCHROME BC1 COMPLEX
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVY
TWGTQEFEKSKRKNPAAYENDR
>1be3_I mol:protein length:78  CYTOCHROME BC1 COMPLEX
MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQA
AGRPLVASVSLNVPASVRY
>1be3_A mol:protein length:446  CYTOCHROME BC1 COMPLEX
TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFV
EHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQ
NCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKL
SRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRF
TGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLA
SIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEV
LRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSK
YFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
>1be3_K mol:protein length:56  CYTOCHROME BC1 COMPLEX
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPYINGKFKKDD