>1bf4_A mol:protein length:63  PROTEIN (CHROMOSOMAL PROTEIN SSO7D)
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLE
KQKK