>1bhi_A mol:protein length:38  CRE-BP1
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFG
>1bhi_A mol:protein length:38  CRE-BP1
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFG