>1bhl_A mol:protein length:151  HIV-1 INTEGRASE
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT
DNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKT
AVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD