>1blr_A mol:protein length:137  CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGE
LILTMTADDVVCTRVYVRE