>1bph_A mol:protein length:21  INSULIN A CHAIN (PH 9)
GIVEQCCASVCSLYQLENYCN
>1bph_B mol:protein length:30  INSULIN B CHAIN (PH 9)
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
>1bph_B mol:protein length:30  INSULIN B CHAIN (PH 9)
FVNQHLCGSHLVEALYLVCGERGFFYTPKA