>1bq9_A mol:protein length:54  PROTEIN (RUBREDOXIN)
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
>1bq9_A mol:protein length:54  PROTEIN (RUBREDOXIN)
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED