>1bwa_A mol:protein length:99  PROTEIN (HIV-1 PROTEASE)
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQY
DQILIEICGHKAIGTVLVGPTPFNVIGRNLLTQIGCTLNF