>1c72_B mol:protein length:219  PROTEIN (GLUTATHIONE S-TRANSFERASE)
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNL
PYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPD
FEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQ
GNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
>1c72_A mol:protein length:219  PROTEIN (GLUTATHIONE S-TRANSFERASE)
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNL
PYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPD
FEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQ
GNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
>1c72_C mol:protein length:219  PROTEIN (GLUTATHIONE S-TRANSFERASE)
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNL
PYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPD
FEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQ
GNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
>1c72_D mol:protein length:219  PROTEIN (GLUTATHIONE S-TRANSFERASE)
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNL
PYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPD
FEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQ
GNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
>1c72_D mol:protein length:219  PROTEIN (GLUTATHIONE S-TRANSFERASE)
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNL
PYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPD
FEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQ
GNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE