>1c72_A mol:protein length:219  PROTEIN (GLUTATHIONE S-TRANSFERASE)
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNL
PYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPD
FEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQ
GNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE