>1c7c_A mol:protein length:283  PROTEIN (DEOXYHEMOGLOBIN (ALPHA CHAIN))
MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFT
PAVHASLDKFLASVSTVLTSKYRGVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLS
FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVD
PVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR