>1c7c_B mol:protein length:146  PROTEIN (DEOXYHEMOGLOBIN (BETA CHAIN))
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGKVLVCVLAHHF
GKEFTPPVQAAYQKVVAGVANALAHKYH