>1c7g_D mol:protein length:456  TYROSINE PHENOL-LYASE
MNYPAEPFRIKSVETVSMISRDERVKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDK
QWAGMMIGDEAYAGSENFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVA
GNMYFTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKGDIDLNKLATLIKEKGAENIAY
ICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYENVS
IKDIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLA
GRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLREAGVPIVEPTGGHAVFLDARRFCP
HLTQDQFPAQSLAASIYMETGVRSMERGIVSAGRSKETGENHRPKLETVRLTIPRRVYT
YAHMDVVADGIIKLYQHKEDIRGLTFVYEPKQLRFFTARFDFI