>1c9t_A mol:protein length:223  TRYPSIN
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVE
GNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLI
SGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDS
GGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN