>1c9t_G mol:protein length:59  BDELLASTASIN
FDVNSHTTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ