>1cgp_B mol:protein length:205  PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP))
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSA
QMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVG
CSRETVGRILKMLEDQNLISAHGKTIVV
>1cgp_F mol:na length:13  DNA (5'-D(*GP*TP*CP*AP*CP*AP*CP*TP*TP*TP*TP*CP*G)-3')
GTCACACTTTTCG
>1cgp_E mol:na length:18  DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*AP*T)-3')
GCGAAAAGTGTGACATAT
>1cgp_D mol:na length:13  DNA (5'-D(*GP*TP*CP*AP*CP*AP*CP*TP*TP*TP*TP*CP*G)-3')
GTCACACTTTTCG
>1cgp_F mol:na length:13  DNA (5'-D(*GP*TP*CP*AP*CP*AP*CP*TP*TP*TP*TP*CP*G)-3')
GTCACACTTTTCG
>1cgp_A mol:protein length:205  PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP))
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSA
QMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVG
CSRETVGRILKMLEDQNLISAHGKTIVV
>1cgp_C mol:na length:18  DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*AP*T)-3')
GCGAAAAGTGTGACATAT