>1ckb_A mol:protein length:57  C-CRK N-TERMINAL SH3 DOMAIN
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
>1ckb_B mol:protein length:10  SOS PEPTIDE (PRO-PRO-PRO-VAL-PRO-PRO-ARG-ARG-ARG-ARG)
PPPVPPRRRR
>1ckb_B mol:protein length:10  SOS PEPTIDE (PRO-PRO-PRO-VAL-PRO-PRO-ARG-ARG-ARG-ARG)
PPPVPPRRRR