>1cl7_I mol:protein length:82  PROTEIN (IGG1 ANTIBODY 1696 (constant heavy chain))
SMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSET
VTCNVAHPASSTKVDKKIVPRDC
>1cl7_I mol:protein length:82  PROTEIN (IGG1 ANTIBODY 1696 (constant heavy chain))
SMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSET
VTCNVAHPASSTKVDKKIVPRDC
>1cl7_L mol:protein length:216  PROTEIN (IGG1 ANTIBODY 1696 (light chain))
DVLMTQTPLYLPVSLGDQASISCRSSQTIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNR
FSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFPPTFGGGTKLEIKRADAAP
TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
>1cl7_H mol:protein length:135  PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain))
QIQLQQSGPELKKPGETVKISCKATNYAFTDYSMHWVKQAPGGDLKYVGWINTETDEPT
FADDFKGRFAFSLDTSTSTAFLQINNLKNEDTATYFCVRDRHDYGEIFTYWGQGTTVTV
SSAKTTPPSVYPLAPGS