>1cmo_A mol:protein length:127  POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGND
ENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKIT
VDGPREPRR
>1cmo_A mol:protein length:127  POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGND
ENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKIT
VDGPREPRR