>1cok_A mol:protein length:68  PROTEIN (SECOND SPLICE VARIANT P73)
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGL
QDLKQGHDY
>1cok_A mol:protein length:68  PROTEIN (SECOND SPLICE VARIANT P73)
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGL
QDLKQGHDY