>1cse_I mol:protein length:70  EGLIN C
TEFGSELKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPG
TNVVNHVPHVG