>1ct8_A mol:protein length:214  7C8 FAB FRAGMENT; SHORT CHAIN
ELVMTQTPATLSVTPGDSVSLSCRASQSVSNKLHWYQQKSHESPRLLIKFASQSIPGIP
SRFSGSGSGSDFTLSINSVETEDFGIYFCHQTHGRPLTFGAGTKLELKRADAAPTVSIF
PPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1ct8_B mol:protein length:220  7C8 FAB FRAGMENT; LONG CHAIN
QVKLLESGAVLVKPGASVKLSCKTSGFTFSSSYINWLKQKPGQSLEWIAWIYAGSGGTV
YNQHFTDKARLTVDTSSSTAYMQFSSLTTEDSAIYYCARYRYDEGFAYWGQGTLVTVSA
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
>1ct8_C mol:protein length:214  7C8 FAB FRAGMENT; SHORT CHAIN
ELVMTQTPATLSVTPGDSVSLSCRASQSVSNKLHWYQQKSHESPRLLIKFASQSIPGIP
SRFSGSGSGSDFTLSINSVETEDFGIYFCHQTHGRPLTFGAGTKLELKRADAAPTVSIF
PPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1ct8_D mol:protein length:220  7C8 FAB FRAGMENT; LONG CHAIN
QVKLLESGAVLVKPGASVKLSCKTSGFTFSSSYINWLKQKPGQSLEWIAWIYAGSGGTV
YNQHFTDKARLTVDTSSSTAYMQFSSLTTEDSAIYYCARYRYDEGFAYWGQGTLVTVSA
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
>1ct8_D mol:protein length:220  7C8 FAB FRAGMENT; LONG CHAIN
QVKLLESGAVLVKPGASVKLSCKTSGFTFSSSYINWLKQKPGQSLEWIAWIYAGSGGTV
YNQHFTDKARLTVDTSSSTAYMQFSSLTTEDSAIYYCARYRYDEGFAYWGQGTLVTVSA
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC