>1cxw_A mol:protein length:60  HUMAN MATRIX METALLOPROTEINASE 2
TALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPET
A
>1cxw_A mol:protein length:60  HUMAN MATRIX METALLOPROTEINASE 2
TALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPET
A