>1d8j_A mol:protein length:81  GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEAL
VNNPKIEVIDGKYAFKPKYNVR