>1dbw_B mol:protein length:126  TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPD
MSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
SEHLVALE
>1dbw_B mol:protein length:126  TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPD
MSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
SEHLVALE
>1dbw_A mol:protein length:126  TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPD
MSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
SEHLVALE