>1dst_A mol:protein length:228  FACTOR D
ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHS
LSQPEPSKRLYDVLRAVPHPDYQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVA
PGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRD
SCKGDSGGPLVCGGVLEGVVSWGSRVCGNRKKPGIYTRVASYAAWIDSVLA
>1dst_A mol:protein length:228  FACTOR D
ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHS
LSQPEPSKRLYDVLRAVPHPDYQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVA
PGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRD
SCKGDSGGPLVCGGVLEGVVSWGSRVCGNRKKPGIYTRVASYAAWIDSVLA