>1dux_F mol:protein length:94  ETS-DOMAIN PROTEIN ELK-1
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDK
LSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGC