>1e9t_A mol:protein length:59  INTESTINAL TREFOIL FACTOR
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF