>1ean_A mol:protein length:140  RUNT-RELATED TRANSCRIPTION FACTOR 1
SGDRSMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVT
VMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH
RAIKITVDGPREPRRHRQKLDD