>1eg0_O mol:na length:76  FORMYL-METHIONYL-TRNA
CGCGGGGUGGAGCAGCCGGUAGCUCGUCGGGCUCAUAACCCGAAGAUCGUCGGUUCAAA
UCCGGCCCCCGCAACCA
>1eg0_O mol:na length:76  FORMYL-METHIONYL-TRNA
CGCGGGGUGGAGCAGCCGGUAGCUCGUCGGGCUCAUAACCCGAAGAUCGUCGGUUCAAA
UCCGGCCCCCGCAACCA
>1eg0_I mol:na length:33  FRAGMENT OF 16S RRNA HELIX 23
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
>1eg0_E mol:protein length:138  PROTEIN (S8 RIBOSOMAL PROTEIN)
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYL
RVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGV
LTDREARKLGVGGELICEVW
>1eg0_K mol:protein length:140  PROTEIN (RIBOSOMAL PROTEIN L11)
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVIT
VYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNA
NSLEAAMKIIEGTAKSMGIEVV
>1eg0_D mol:protein length:146  PROTEIN (S7 RIBOSOMAL PROTEIN)
MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPL
KVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAV
RIAHELMDAAEGKGGAVKKKEDVERMAE
>1eg0_F mol:protein length:89  PROTEIN (S15 RIBOSOMAL PROTEIN)
MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMM
VGQRRRLLRYLQREDPERYRALIEKLGIRG
>1eg0_M mol:na length:26  HELIX 95 OF 23S RRNA
GCUCCUAGUACGAGAGGACCGGAGUG
>1eg0_J mol:protein length:171  PROTEIN (RIBOSOMAL PROTEIN L6)
MSRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVEGNVITVTRPSDEK
HHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPE
EGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIRYEGELVRL
>1eg0_C mol:protein length:97  PROTEIN (S6 RIBOSOMAL PROTEIN)
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGY
FLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPF
>1eg0_A mol:protein length:159  PROTEIN (S4 RIBOSOMAL PROTEIN)
MKLSEYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLESRLDNLVYR
LGLARTRRQARQLVTHGHILVDGSRVNIPSYRVKPGQTIAVREKSRNLQVIKEALEANN
YIPDYLSFDPEKMEGTYTRLPERSELPAEINEALIVEFYSR
>1eg0_B mol:protein length:148  PROTEIN (S5 RIBOSOMAL PROTEIN)
MRRINPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEA
IRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELA
GISDILSKSIGSNTPINMVRATFDGLKQLK
>1eg0_G mol:protein length:93  PROTEIN (S17 RIBOSOMAL PROTEIN)
SERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDI
VKIMETRPLSATKRFRLVEIVEKAVRAGAGAGAA
>1eg0_L mol:na length:57  FRAGMENT OF 23S RRNA
CUGGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAGUGCGUAACAGCUCACCAGC
>1eg0_N mol:protein length:229  PROTEIN (RIBOSOMAL PROTEIN L1)
MPKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNV
RGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATP
DVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVG
KASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
>1eg0_H mol:protein length:100  PROTEIN (S20 RIBOSOMAL PROTEIN)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX