>1eg0_E mol:protein length:138  PROTEIN (S8 RIBOSOMAL PROTEIN)
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYL
RVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGV
LTDREARKLGVGGELICEVW