>1eg0_K mol:protein length:140  PROTEIN (RIBOSOMAL PROTEIN L11)
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVIT
VYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNA
NSLEAAMKIIEGTAKSMGIEVV