>1en6_C mol:protein length:205  MANGANESE SUPEROXIDE DISMUTASE
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEK
AAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASGFPIMGLDVWEHAYYLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK