>1en6_D mol:protein length:205  MANGANESE SUPEROXIDE DISMUTASE
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEK
AAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASGFPIMGLDVWEHAYYLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK