>1esd_A mol:protein length:306  ESTERASE
APADPVPTVFFGDSYTANFGIAPVTNQDSERGWCFQAKENYPAVATRSLADKGITLDVQ
ADVSCGGALIHHFWEKQELPFGAGELPPQQDALKQDTQLTVGSLGGNTLGFNRILKQCS
DELRKPSLLPGDPVDGDEPAAKCGEFFGTGDGKQWLDDQFERVGAELEELLDRIGYFAP
DAKRVLVGYPRLVPEDTTKCLTAAPGQTQLPFADIPQDALPVLDQIQKRLNDAMKKAAA
DGGADFVDLYAGTGANTACDGADRGIGGLLEDSQLELLGTKIPWYAHPNDKGRDIQAKQ
VADKIEEILNR