>1ev3_D mol:protein length:30  INSULIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT