>1ev6_B mol:protein length:30  INSULIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT