>1ev6_H mol:protein length:30  INSULIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT