>1exr_A mol:protein length:148  CALMODULIN
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTD
DEVDEMIREADIDGDGHINYEEFVRMMVSK