>1f15_A mol:protein length:218  COAT PROTEIN
MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFV
GSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFD
STVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADI
GDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
>1f15_C mol:protein length:218  COAT PROTEIN
MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFV
GSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFD
STVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADI
GDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
>1f15_B mol:protein length:218  COAT PROTEIN
MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFV
GSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFD
STVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADI
GDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
>1f15_C mol:protein length:218  COAT PROTEIN
MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFV
GSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFD
STVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADI
GDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV